ADPRH monoclonal antibody (M04), clone 1F11 View larger

ADPRH monoclonal antibody (M04), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADPRH monoclonal antibody (M04), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA

More info about ADPRH monoclonal antibody (M04), clone 1F11

Brand: Abnova
Reference: H00000141-M04
Product name: ADPRH monoclonal antibody (M04), clone 1F11
Product description: Mouse monoclonal antibody raised against a partial recombinant ADPRH.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 141
Gene name: ADPRH
Gene alias: ARH1
Gene description: ADP-ribosylarginine hydrolase
Genbank accession: NM_001125
Immunogen: ADPRH (NP_001116.1, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIP
Protein accession: NP_001116.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000141-M04-1-9-1.jpg
Application image note: ADPRH monoclonal antibody (M04), clone 1F11. Western Blot analysis of ADPRH expression in K-562(Cat # L009V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADPRH monoclonal antibody (M04), clone 1F11 now

Add to cart