Brand: | Abnova |
Reference: | H00000141-M04 |
Product name: | ADPRH monoclonal antibody (M04), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADPRH. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 141 |
Gene name: | ADPRH |
Gene alias: | ARH1 |
Gene description: | ADP-ribosylarginine hydrolase |
Genbank accession: | NM_001125 |
Immunogen: | ADPRH (NP_001116.1, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIP |
Protein accession: | NP_001116.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ADPRH monoclonal antibody (M04), clone 1F11. Western Blot analysis of ADPRH expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |