ADORA3 monoclonal antibody (M01), clone 1A3 View larger

ADORA3 monoclonal antibody (M01), clone 1A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADORA3 monoclonal antibody (M01), clone 1A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADORA3 monoclonal antibody (M01), clone 1A3

Brand: Abnova
Reference: H00000140-M01
Product name: ADORA3 monoclonal antibody (M01), clone 1A3
Product description: Mouse monoclonal antibody raised against a partial recombinant ADORA3.
Clone: 1A3
Isotype: IgG2b Kappa
Gene id: 140
Gene name: ADORA3
Gene alias: A3AR|AD026|bA552M11.5
Gene description: adenosine A3 receptor
Genbank accession: BC029831
Immunogen: ADORA3 (AAH29831, 121 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
Protein accession: AAH29831
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000140-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ADORA3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Adenosine receptor expression in rheumatoid synovium: a basis for methotrexate action.Stamp LK, Hazlett J, Roberts RL, Frampton C, Highton J, Hessian PA.
Arthritis Res Ther. 2012 Jun 8;14(3):R138.

Reviews

Buy ADORA3 monoclonal antibody (M01), clone 1A3 now

Add to cart