Brand: | Abnova |
Reference: | H00000140-M01 |
Product name: | ADORA3 monoclonal antibody (M01), clone 1A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADORA3. |
Clone: | 1A3 |
Isotype: | IgG2b Kappa |
Gene id: | 140 |
Gene name: | ADORA3 |
Gene alias: | A3AR|AD026|bA552M11.5 |
Gene description: | adenosine A3 receptor |
Genbank accession: | BC029831 |
Immunogen: | ADORA3 (AAH29831, 121 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE |
Protein accession: | AAH29831 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADORA3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Adenosine receptor expression in rheumatoid synovium: a basis for methotrexate action.Stamp LK, Hazlett J, Roberts RL, Frampton C, Highton J, Hessian PA. Arthritis Res Ther. 2012 Jun 8;14(3):R138. |