Brand: | Abnova |
Reference: | H00000135-M17 |
Product name: | ADORA2A monoclonal antibody (M17), clone 4E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADORA2A. |
Clone: | 4E4 |
Isotype: | IgG1 Kappa |
Gene id: | 135 |
Gene name: | ADORA2A |
Gene alias: | ADORA2|RDC8|hA2aR |
Gene description: | adenosine A2a receptor |
Genbank accession: | NM_000675.3 |
Immunogen: | ADORA2A (NP_000666.2, 147 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL |
Protein accession: | NP_000666.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADORA2A is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |