ADORA2A monoclonal antibody (M17), clone 4E4 View larger

ADORA2A monoclonal antibody (M17), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADORA2A monoclonal antibody (M17), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about ADORA2A monoclonal antibody (M17), clone 4E4

Brand: Abnova
Reference: H00000135-M17
Product name: ADORA2A monoclonal antibody (M17), clone 4E4
Product description: Mouse monoclonal antibody raised against a partial recombinant ADORA2A.
Clone: 4E4
Isotype: IgG1 Kappa
Gene id: 135
Gene name: ADORA2A
Gene alias: ADORA2|RDC8|hA2aR
Gene description: adenosine A2a receptor
Genbank accession: NM_000675.3
Immunogen: ADORA2A (NP_000666.2, 147 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL
Protein accession: NP_000666.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000135-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000135-M17-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ADORA2A is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy ADORA2A monoclonal antibody (M17), clone 4E4 now

Add to cart