ADORA2A purified MaxPab mouse polyclonal antibody (B01P) View larger

ADORA2A purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADORA2A purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr,Flow Cyt

More info about ADORA2A purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000135-B01P
Product name: ADORA2A purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ADORA2A protein.
Gene id: 135
Gene name: ADORA2A
Gene alias: ADORA2|RDC8|hA2aR
Gene description: adenosine A2a receptor
Genbank accession: CF147807
Immunogen: ADORA2A (AAH13780.1, 1 a.a. ~ 412 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Protein accession: AAH13780.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000135-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ADORA2A expression in transfected 293T cell line (H00000135-T02) by ADORA2A MaxPab polyclonal antibody.

Lane 1: ADORA2A transfected lysate(45.43 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr,Flow Cyt
Shipping condition: Dry Ice

Reviews

Buy ADORA2A purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart