ADK monoclonal antibody (M01), clone 4E7 View larger

ADK monoclonal antibody (M01), clone 4E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADK monoclonal antibody (M01), clone 4E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADK monoclonal antibody (M01), clone 4E7

Brand: Abnova
Reference: H00000132-M01
Product name: ADK monoclonal antibody (M01), clone 4E7
Product description: Mouse monoclonal antibody raised against a partial recombinant ADK.
Clone: 4E7
Isotype: IgG2a Kappa
Gene id: 132
Gene name: ADK
Gene alias: AK
Gene description: adenosine kinase
Genbank accession: NM_001123
Immunogen: ADK (NP_001114, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
Protein accession: NP_001114
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000132-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000132-M01-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged ADK is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADK monoclonal antibody (M01), clone 4E7 now

Add to cart