ADK polyclonal antibody (A01) View larger

ADK polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADK polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ADK polyclonal antibody (A01)

Brand: Abnova
Reference: H00000132-A01
Product name: ADK polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ADK.
Gene id: 132
Gene name: ADK
Gene alias: AK
Gene description: adenosine kinase
Genbank accession: NM_001123
Immunogen: ADK (NP_001114, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
Protein accession: NP_001114
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000132-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000132-A01-1-2-1.jpg
Application image note: ADK polyclonal antibody (A01), Lot # 051116JC01 Western Blot analysis of ADK expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADK polyclonal antibody (A01) now

Add to cart