Brand: | Abnova |
Reference: | H00000130-A01 |
Product name: | ADH6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ADH6. |
Gene id: | 130 |
Gene name: | ADH6 |
Gene alias: | ADH-5 |
Gene description: | alcohol dehydrogenase 6 (class V) |
Genbank accession: | NM_000672 |
Immunogen: | ADH6 (NP_000663, 55 a.a. ~ 144 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT |
Protein accession: | NP_000663 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |