ADH4 monoclonal antibody (M03A), clone 1D2 View larger

ADH4 monoclonal antibody (M03A), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADH4 monoclonal antibody (M03A), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about ADH4 monoclonal antibody (M03A), clone 1D2

Brand: Abnova
Reference: H00000127-M03A
Product name: ADH4 monoclonal antibody (M03A), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant ADH4.
Clone: 1D2
Isotype: IgG2a Kappa
Gene id: 127
Gene name: ADH4
Gene alias: ADH-2
Gene description: alcohol dehydrogenase 4 (class II), pi polypeptide
Genbank accession: NM_000670
Immunogen: ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS
Protein accession: NP_000661
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000127-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000127-M03A-1-25-1.jpg
Application image note: ADH4 monoclonal antibody (M03A), clone 1D2. Western Blot analysis of ADH4 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADH4 monoclonal antibody (M03A), clone 1D2 now

Add to cart