Brand: | Abnova |
Reference: | H00000127-M03A |
Product name: | ADH4 monoclonal antibody (M03A), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADH4. |
Clone: | 1D2 |
Isotype: | IgG2a Kappa |
Gene id: | 127 |
Gene name: | ADH4 |
Gene alias: | ADH-2 |
Gene description: | alcohol dehydrogenase 4 (class II), pi polypeptide |
Genbank accession: | NM_000670 |
Immunogen: | ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS |
Protein accession: | NP_000661 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ADH4 monoclonal antibody (M03A), clone 1D2. Western Blot analysis of ADH4 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |