ADH1A monoclonal antibody (M01), clone 2G2 View larger

ADH1A monoclonal antibody (M01), clone 2G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADH1A monoclonal antibody (M01), clone 2G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ADH1A monoclonal antibody (M01), clone 2G2

Brand: Abnova
Reference: H00000124-M01
Product name: ADH1A monoclonal antibody (M01), clone 2G2
Product description: Mouse monoclonal antibody raised against a partial recombinant ADH1A.
Clone: 2G2
Isotype: IgG2a Kappa
Gene id: 124
Gene name: ADH1A
Gene alias: ADH1
Gene description: alcohol dehydrogenase 1A (class I), alpha polypeptide
Genbank accession: NM_000667
Immunogen: ADH1A (NP_000658, 298 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF
Protein accession: NP_000658
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000124-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADH1A monoclonal antibody (M01), clone 2G2 now

Add to cart