Brand: | Abnova |
Reference: | H00000117-M01 |
Product name: | ADCYAP1R1 monoclonal antibody (M01), clone 2B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADCYAP1R1. |
Clone: | 2B12 |
Isotype: | IgG1 Kappa |
Gene id: | 117 |
Gene name: | ADCYAP1R1 |
Gene alias: | PAC1|PACAPR|PACAPRI |
Gene description: | adenylate cyclase activating polypeptide 1 (pituitary) receptor type I |
Genbank accession: | NM_001118 |
Immunogen: | ADCYAP1R1 (NP_001109, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE |
Protein accession: | NP_001109 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ADCYAP1R1 monoclonal antibody (M01), clone 2B12 Western Blot analysis of ADCYAP1R1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |