ADCYAP1R1 monoclonal antibody (M01), clone 2B12 View larger

ADCYAP1R1 monoclonal antibody (M01), clone 2B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCYAP1R1 monoclonal antibody (M01), clone 2B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ADCYAP1R1 monoclonal antibody (M01), clone 2B12

Brand: Abnova
Reference: H00000117-M01
Product name: ADCYAP1R1 monoclonal antibody (M01), clone 2B12
Product description: Mouse monoclonal antibody raised against a partial recombinant ADCYAP1R1.
Clone: 2B12
Isotype: IgG1 Kappa
Gene id: 117
Gene name: ADCYAP1R1
Gene alias: PAC1|PACAPR|PACAPRI
Gene description: adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
Genbank accession: NM_001118
Immunogen: ADCYAP1R1 (NP_001109, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
Protein accession: NP_001109
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000117-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000117-M01-1-1-1.jpg
Application image note: ADCYAP1R1 monoclonal antibody (M01), clone 2B12 Western Blot analysis of ADCYAP1R1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADCYAP1R1 monoclonal antibody (M01), clone 2B12 now

Add to cart