ADCY7 polyclonal antibody (A01) View larger

ADCY7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCY7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ADCY7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00000113-A01
Product name: ADCY7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ADCY7.
Gene id: 113
Gene name: ADCY7
Gene alias: AC7|FLJ36387|KIAA0037
Gene description: adenylate cyclase 7
Genbank accession: NM_001114
Immunogen: ADCY7 (NP_001105, 197 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
Protein accession: NP_001105
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice
Publications: Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4(+) T cells.Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V.
Mol Immunol. 2009 Nov 23. [Epub ahead of print]

Reviews

Buy ADCY7 polyclonal antibody (A01) now

Add to cart