ADCY5 monoclonal antibody (M01), clone 3E6 View larger

ADCY5 monoclonal antibody (M01), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCY5 monoclonal antibody (M01), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ADCY5 monoclonal antibody (M01), clone 3E6

Brand: Abnova
Reference: H00000111-M01
Product name: ADCY5 monoclonal antibody (M01), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant ADCY5.
Clone: 3E6
Isotype: IgG2b Kappa
Gene id: 111
Gene name: ADCY5
Gene alias: AC5
Gene description: adenylate cyclase 5
Genbank accession: NM_183357
Immunogen: ADCY5 (NP_899200, 1152 a.a. ~ 1261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Protein accession: NP_899200
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000111-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000111-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ADCY5 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: An adenylyl cyclase signaling pathway predicts direct dopaminergic input to vestibular hair cells.Drescher MJ, Cho WJ, Folbe AJ, Selvakumar D, Kewson DT, Abu-Hamdan MD, Oh CK, Ramakrishnan NA, Hatfield JS, Khan KM, Anne S, Harpool EC, Drescher DG.
Neuroscience. 2010 Sep 29. [Epub ahead of print]

Reviews

Buy ADCY5 monoclonal antibody (M01), clone 3E6 now

Add to cart