Brand: | Abnova |
Reference: | H00000111-M01 |
Product name: | ADCY5 monoclonal antibody (M01), clone 3E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADCY5. |
Clone: | 3E6 |
Isotype: | IgG2b Kappa |
Gene id: | 111 |
Gene name: | ADCY5 |
Gene alias: | AC5 |
Gene description: | adenylate cyclase 5 |
Genbank accession: | NM_183357 |
Immunogen: | ADCY5 (NP_899200, 1152 a.a. ~ 1261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS |
Protein accession: | NP_899200 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADCY5 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | An adenylyl cyclase signaling pathway predicts direct dopaminergic input to vestibular hair cells.Drescher MJ, Cho WJ, Folbe AJ, Selvakumar D, Kewson DT, Abu-Hamdan MD, Oh CK, Ramakrishnan NA, Hatfield JS, Khan KM, Anne S, Harpool EC, Drescher DG. Neuroscience. 2010 Sep 29. [Epub ahead of print] |