Brand: | Abnova |
Reference: | H00000108-M01 |
Product name: | ADCY2 monoclonal antibody (M01), clone 1D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADCY2. |
Clone: | 1D4 |
Isotype: | IgG2b Kappa |
Gene id: | 108 |
Gene name: | ADCY2 |
Gene alias: | AC2|FLJ16822|FLJ45092|HBAC2|KIAA1060|MGC133314 |
Gene description: | adenylate cyclase 2 (brain) |
Genbank accession: | NM_020546 |
Immunogen: | ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS |
Protein accession: | NP_065433 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADCY2 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,PLA-Ce |
Shipping condition: | Dry Ice |