ADCY2 monoclonal antibody (M01), clone 1D4 View larger

ADCY2 monoclonal antibody (M01), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCY2 monoclonal antibody (M01), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,PLA-Ce

More info about ADCY2 monoclonal antibody (M01), clone 1D4

Brand: Abnova
Reference: H00000108-M01
Product name: ADCY2 monoclonal antibody (M01), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant ADCY2.
Clone: 1D4
Isotype: IgG2b Kappa
Gene id: 108
Gene name: ADCY2
Gene alias: AC2|FLJ16822|FLJ45092|HBAC2|KIAA1060|MGC133314
Gene description: adenylate cyclase 2 (brain)
Genbank accession: NM_020546
Immunogen: ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
Protein accession: NP_065433
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000108-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ADCY2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy ADCY2 monoclonal antibody (M01), clone 1D4 now

Add to cart