Brand: | Abnova |
Reference: | H00000097-M01 |
Product name: | ACYP1 monoclonal antibody (M01), clone 1B2-3A2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ACYP1. |
Clone: | 1B2-3A2 |
Isotype: | IgG2b kappa |
Gene id: | 97 |
Gene name: | ACYP1 |
Gene alias: | ACYPE |
Gene description: | acylphosphatase 1, erythrocyte (common) type |
Genbank accession: | BC035568 |
Immunogen: | ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
Protein accession: | AAH35568 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ACYP1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |