ACYP1 monoclonal antibody (M01), clone 1B2-3A2 View larger

ACYP1 monoclonal antibody (M01), clone 1B2-3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACYP1 monoclonal antibody (M01), clone 1B2-3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACYP1 monoclonal antibody (M01), clone 1B2-3A2

Brand: Abnova
Reference: H00000097-M01
Product name: ACYP1 monoclonal antibody (M01), clone 1B2-3A2
Product description: Mouse monoclonal antibody raised against a full length recombinant ACYP1.
Clone: 1B2-3A2
Isotype: IgG2b kappa
Gene id: 97
Gene name: ACYP1
Gene alias: ACYPE
Gene description: acylphosphatase 1, erythrocyte (common) type
Genbank accession: BC035568
Immunogen: ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Protein accession: AAH35568
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000097-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000097-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACYP1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACYP1 monoclonal antibody (M01), clone 1B2-3A2 now

Add to cart