ACY1 monoclonal antibody (M01), clone 4F1-B7 View larger

ACY1 monoclonal antibody (M01), clone 4F1-B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACY1 monoclonal antibody (M01), clone 4F1-B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about ACY1 monoclonal antibody (M01), clone 4F1-B7

Brand: Abnova
Reference: H00000095-M01
Product name: ACY1 monoclonal antibody (M01), clone 4F1-B7
Product description: Mouse monoclonal antibody raised against a full length recombinant ACY1.
Clone: 4F1-B7
Isotype: IgG1 kappa
Gene id: 95
Gene name: ACY1
Gene alias: ACY1D|ACYLASE
Gene description: aminoacylase 1
Genbank accession: BC000545
Immunogen: ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Protein accession: AAH00545
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000095-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (70.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000095-M01-3-27-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ACY1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice
Publications: Prodefensin-A6 Assay Method for The In Vitro Diagnosis of Colorectal Cancer.Ataman-onal Y, Beaulieu C, Busseret S, Charrier J, Choquet-kastylevsky G, Rolland D.
United States Patent Application. 2015 Sept. US20150253342A1

Reviews

Buy ACY1 monoclonal antibody (M01), clone 4F1-B7 now

Add to cart