Brand: | Abnova |
Reference: | H00000095-M01 |
Product name: | ACY1 monoclonal antibody (M01), clone 4F1-B7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ACY1. |
Clone: | 4F1-B7 |
Isotype: | IgG1 kappa |
Gene id: | 95 |
Gene name: | ACY1 |
Gene alias: | ACY1D|ACYLASE |
Gene description: | aminoacylase 1 |
Genbank accession: | BC000545 |
Immunogen: | ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
Protein accession: | AAH00545 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (70.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ACY1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | Prodefensin-A6 Assay Method for The In Vitro Diagnosis of Colorectal Cancer.Ataman-onal Y, Beaulieu C, Busseret S, Charrier J, Choquet-kastylevsky G, Rolland D. United States Patent Application. 2015 Sept. US20150253342A1 |