Brand: | Abnova |
Reference: | H00000094-M09 |
Product name: | ACVRL1 monoclonal antibody (M09), clone 1E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACVRL1. |
Clone: | 1E7 |
Isotype: | IgG2a Kappa |
Gene id: | 94 |
Gene name: | ACVRL1 |
Gene alias: | ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I |
Gene description: | activin A receptor type II-like 1 |
Genbank accession: | BC042637 |
Immunogen: | ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
Protein accession: | AAH42637 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ACVRL1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |