ACVRL1 monoclonal antibody (M06), clone 2C12 View larger

ACVRL1 monoclonal antibody (M06), clone 2C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVRL1 monoclonal antibody (M06), clone 2C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about ACVRL1 monoclonal antibody (M06), clone 2C12

Brand: Abnova
Reference: H00000094-M06
Product name: ACVRL1 monoclonal antibody (M06), clone 2C12
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Clone: 2C12
Isotype: IgG2a Kappa
Gene id: 94
Gene name: ACVRL1
Gene alias: ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene description: activin A receptor type II-like 1
Genbank accession: BC042637
Immunogen: ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Protein accession: AAH42637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000094-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000094-M06-13-15-1.jpg
Application image note: Western Blot analysis of ACVRL1 expression in transfected 293T cell line by ACVRL1 monoclonal antibody (M06), clone 2C12.

Lane 1: ACVRL1 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACVRL1 monoclonal antibody (M06), clone 2C12 now

Add to cart