Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00000094-M01 |
Product name: | ACVRL1 monoclonal antibody (M01), clone 5B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACVRL1. |
Clone: | 5B1 |
Isotype: | IgG1 Kappa |
Gene id: | 94 |
Gene name: | ACVRL1 |
Gene alias: | ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I |
Gene description: | activin A receptor type II-like 1 |
Genbank accession: | BC042637 |
Immunogen: | ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL |
Protein accession: | AAH42637 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ACVRL1 expression in transfected 293T cell line by ACVRL1 monoclonal antibody (M01), clone 5B1. Lane 1: ACVRL1 transfected lysate(56.124 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |