ACVR2B monoclonal antibody (M03), clone 1C11 View larger

ACVR2B monoclonal antibody (M03), clone 1C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR2B monoclonal antibody (M03), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACVR2B monoclonal antibody (M03), clone 1C11

Brand: Abnova
Reference: H00000093-M03
Product name: ACVR2B monoclonal antibody (M03), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR2B.
Clone: 1C11
Isotype: IgG2a Kappa
Gene id: 93
Gene name: ACVR2B
Gene alias: ACTRIIB|ActR-IIB|MGC116908
Gene description: activin A receptor, type IIB
Genbank accession: NM_001106
Immunogen: ACVR2B (NP_001097, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Protein accession: NP_001097
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000093-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000093-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ACVR2B is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACVR2B monoclonal antibody (M03), clone 1C11 now

Add to cart