ACVR1B monoclonal antibody (M09), clone 1C1 View larger

ACVR1B monoclonal antibody (M09), clone 1C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACVR1B monoclonal antibody (M09), clone 1C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce

More info about ACVR1B monoclonal antibody (M09), clone 1C1

Brand: Abnova
Reference: H00000091-M09
Product name: ACVR1B monoclonal antibody (M09), clone 1C1
Product description: Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Clone: 1C1
Isotype: IgG1 Kappa
Gene id: 91
Gene name: ACVR1B
Gene alias: ACTRIB|ACVRLK4|ALK4|SKR2
Gene description: activin A receptor, type IB
Genbank accession: BC000254
Immunogen: ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Protein accession: AAH00254
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000091-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000091-M09-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACVR1B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce
Shipping condition: Dry Ice
Publications: Activin acutely sensitizes dorsal root ganglion neurons and induces hyperalgesia via PKC-mediated potentiation of transient receptor potential vanilloid I.Zhu W, Xu P, Cuascut FX, Hall AK, Oxford GS.
J Neurosci. 2007 Dec 12;27(50):13770-80.

Reviews

Buy ACVR1B monoclonal antibody (M09), clone 1C1 now

Add to cart