ACTN1 monoclonal antibody (M01), clone 3F1 View larger

ACTN1 monoclonal antibody (M01), clone 3F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTN1 monoclonal antibody (M01), clone 3F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ACTN1 monoclonal antibody (M01), clone 3F1

Brand: Abnova
Reference: H00000087-M01
Product name: ACTN1 monoclonal antibody (M01), clone 3F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ACTN1.
Clone: 3F1
Isotype: IgG3 Kappa
Gene id: 87
Gene name: ACTN1
Gene alias: FLJ40884
Gene description: actinin, alpha 1
Genbank accession: NM_001102
Immunogen: ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
Protein accession: NP_001093
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000087-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000087-M01-13-15-1.jpg
Application image note: Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01), clone 3F1.

Lane 1: ACTN1 transfected lysate(103.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Rab13 Small G Protein and Junctional Rab13-binding Protein (JRAB) Orchestrate Actin Cytoskeletal Organization during Epithelial Junctional Development.Sakane A, Abdallah AA, Nakano K, Honda K, Ikeda W, Nishikawa Y, Matsumoto M, Matsushita N, Kitamura T, Sasaki T.
J Biol Chem. 2012 Dec 14;287(51):42455-68. doi: 10.1074/jbc.M112.383653. Epub 2012 Oct 24.

Reviews

Buy ACTN1 monoclonal antibody (M01), clone 3F1 now

Add to cart