ACTN4 monoclonal antibody (M02), clone 1E10 View larger

ACTN4 monoclonal antibody (M02), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTN4 monoclonal antibody (M02), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ACTN4 monoclonal antibody (M02), clone 1E10

Brand: Abnova
Reference: H00000081-M02
Product name: ACTN4 monoclonal antibody (M02), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant ACTN4.
Clone: 1E10
Isotype: IgG2a
Gene id: 81
Gene name: ACTN4
Gene alias: ACTININ-4|DKFZp686K23158|FSGS|FSGS1
Gene description: actinin, alpha 4
Genbank accession: NM_004924
Immunogen: ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Protein accession: NP_004915
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000081-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000081-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ACTN4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACTN4 monoclonal antibody (M02), clone 1E10 now

Add to cart