Brand: | Abnova |
Reference: | H00000081-M01A |
Product name: | ACTN4 monoclonal antibody (M01A), clone 4D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACTN4. |
Clone: | 4D10 |
Isotype: | IgG2a Kappa |
Gene id: | 81 |
Gene name: | ACTN4 |
Gene alias: | ACTININ-4|DKFZp686K23158|FSGS|FSGS1 |
Gene description: | actinin, alpha 4 |
Genbank accession: | NM_004924 |
Immunogen: | ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK |
Protein accession: | NP_004915 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | ACTN4 monoclonal antibody (M01A), clone 4D10 Western Blot analysis of ACTN4 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |