ACPP monoclonal antibody (M01), clone 2D11 View larger

ACPP monoclonal antibody (M01), clone 2D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACPP monoclonal antibody (M01), clone 2D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ACPP monoclonal antibody (M01), clone 2D11

Brand: Abnova
Reference: H00000055-M01
Product name: ACPP monoclonal antibody (M01), clone 2D11
Product description: Mouse monoclonal antibody raised against a partial recombinant ACPP.
Clone: 2D11
Isotype: IgG2b Kappa
Gene id: 55
Gene name: ACPP
Gene alias: ACP-3|ACP3|PAP
Gene description: acid phosphatase, prostate
Genbank accession: BC007460
Immunogen: ACPP (AAH07460, 310 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI
Protein accession: AAH07460
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000055-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACPP is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ACPP monoclonal antibody (M01), clone 2D11 now

Add to cart