ACP5 monoclonal antibody (M01), clone 2D9 View larger

ACP5 monoclonal antibody (M01), clone 2D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACP5 monoclonal antibody (M01), clone 2D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about ACP5 monoclonal antibody (M01), clone 2D9

Brand: Abnova
Reference: H00000054-M01
Product name: ACP5 monoclonal antibody (M01), clone 2D9
Product description: Mouse monoclonal antibody raised against a partial recombinant ACP5.
Clone: 2D9
Isotype: IgG2a Kappa
Gene id: 54
Gene name: ACP5
Gene alias: MGC117378|TRAP
Gene description: acid phosphatase 5, tartrate resistant
Genbank accession: BC025414
Immunogen: ACP5 (AAH25414.1, 72 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Protein accession: AAH25414.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000054-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000054-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ACP5 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACP5 monoclonal antibody (M01), clone 2D9 now

Add to cart