Brand: | Abnova |
Reference: | H00000052-M01 |
Product name: | ACP1 monoclonal antibody (M01), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ACP1. |
Clone: | 4B10 |
Isotype: | IgG2b Kappa |
Gene id: | 52 |
Gene name: | ACP1 |
Gene alias: | HAAP|MGC111030|MGC3499 |
Gene description: | acid phosphatase 1, soluble |
Genbank accession: | BC007422 |
Immunogen: | ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH |
Protein accession: | AAH07422 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | ACP1 monoclonal antibody (M01), clone 4B10. Western Blot analysis of ACP1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |