Brand: | Abnova |
Reference: | H00000050-M01 |
Product name: | ACO2 monoclonal antibody (M01), clone 1A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACO2. |
Clone: | 1A11 |
Isotype: | IgG2a Kappa |
Gene id: | 50 |
Gene name: | ACO2 |
Gene alias: | ACONM|MGC20605|MGC33908 |
Gene description: | aconitase 2, mitochondrial |
Genbank accession: | BC014092 |
Immunogen: | ACO2 (AAH14092, 1 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE |
Protein accession: | AAH14092 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ACO2 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Regulation of mitochondrial aconitase by phosphorylation in diabetic rat heart.Lin G, Brownsey RW, MacLeod KM. Cell Mol Life Sci. 2009 Mar;66(5):919-32. |