ACO1 monoclonal antibody (M01), clone 2C1 View larger

ACO1 monoclonal antibody (M01), clone 2C1

H00000048-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACO1 monoclonal antibody (M01), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about ACO1 monoclonal antibody (M01), clone 2C1

Brand: Abnova
Reference: H00000048-M01
Product name: ACO1 monoclonal antibody (M01), clone 2C1
Product description: Mouse monoclonal antibody raised against a partial recombinant ACO1.
Clone: 2C1
Isotype: IgG2a Kappa
Gene id: 48
Gene name: ACO1
Gene alias: ACONS|IREB1|IREBP|IREBP1|IRP1
Gene description: aconitase 1, soluble
Genbank accession: BC018103
Immunogen: ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Protein accession: AAH18103
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000048-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000048-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice
Publications: IF/TA-related metabolic changes--proteome analysis of rat renal allografts.Reuter S, Reiermann S, Worner R, Schroter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbroker B, Amann K, Pavenstadt H, Schlatter E, Gabriels G.
Nephrol Dial Transplant. 2010 Feb 22. [Epub ahead of print]

Reviews

Buy ACO1 monoclonal antibody (M01), clone 2C1 now

Add to cart