Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACO1 monoclonal antibody (M01), clone 2C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,IP |
More info about ACO1 monoclonal antibody (M01), clone 2C1
| Brand: | Abnova |
| Reference: | H00000048-M01 |
| Product name: | ACO1 monoclonal antibody (M01), clone 2C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACO1. |
| Clone: | 2C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 48 |
| Gene name: | ACO1 |
| Gene alias: | ACONS|IREB1|IREBP|IREBP1|IRP1 |
| Gene description: | aconitase 1, soluble |
| Genbank accession: | BC018103 |
| Immunogen: | ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
| Protein accession: | AAH18103 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | IF/TA-related metabolic changes--proteome analysis of rat renal allografts.Reuter S, Reiermann S, Worner R, Schroter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbroker B, Amann K, Pavenstadt H, Schlatter E, Gabriels G. Nephrol Dial Transplant. 2010 Feb 22. [Epub ahead of print] |