Brand: | Abnova |
Reference: | H00000037-M02 |
Product name: | ACADVL monoclonal antibody (M02), clone 1E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACADVL. |
Clone: | 1E7 |
Isotype: | IgG2b Kappa |
Gene id: | 37 |
Gene name: | ACADVL |
Gene alias: | ACAD6|LCACD|VLCAD |
Gene description: | acyl-Coenzyme A dehydrogenase, very long chain |
Genbank accession: | NM_000018 |
Immunogen: | ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI |
Protein accession: | NP_000009 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |