ACADVL monoclonal antibody (M01), clone 5D3 View larger

ACADVL monoclonal antibody (M01), clone 5D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACADVL monoclonal antibody (M01), clone 5D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about ACADVL monoclonal antibody (M01), clone 5D3

Brand: Abnova
Reference: H00000037-M01
Product name: ACADVL monoclonal antibody (M01), clone 5D3
Product description: Mouse monoclonal antibody raised against a partial recombinant ACADVL.
Clone: 5D3
Isotype: IgG2b Kappa
Gene id: 37
Gene name: ACADVL
Gene alias: ACAD6|LCACD|VLCAD
Gene description: acyl-Coenzyme A dehydrogenase, very long chain
Genbank accession: NM_000018
Immunogen: ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
Protein accession: NP_000009
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000037-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000037-M01-3-3-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies.Nouws J, Te Brinke H, Nijtmans LG, Houten SM
Hum Mol Genet. 2013 Nov 6.

Reviews

Buy ACADVL monoclonal antibody (M01), clone 5D3 now

Add to cart