ACADM monoclonal antibody (M04), clone 3A2 View larger

ACADM monoclonal antibody (M04), clone 3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACADM monoclonal antibody (M04), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ACADM monoclonal antibody (M04), clone 3A2

Brand: Abnova
Reference: H00000034-M04
Product name: ACADM monoclonal antibody (M04), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant ACADM.
Clone: 3A2
Isotype: IgG2b Kappa
Gene id: 34
Gene name: ACADM
Gene alias: ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH
Gene description: acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
Genbank accession: NM_000016
Immunogen: ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
Protein accession: NP_000007
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged ACADM is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ACADM monoclonal antibody (M04), clone 3A2 now

Add to cart