Brand: | Abnova |
Reference: | H00000034-M04 |
Product name: | ACADM monoclonal antibody (M04), clone 3A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACADM. |
Clone: | 3A2 |
Isotype: | IgG2b Kappa |
Gene id: | 34 |
Gene name: | ACADM |
Gene alias: | ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH |
Gene description: | acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
Genbank accession: | NM_000016 |
Immunogen: | ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL |
Protein accession: | NP_000007 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ACADM is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |