Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACADM polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ACADM polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000034-A01 |
| Product name: | ACADM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACADM. |
| Gene id: | 34 |
| Gene name: | ACADM |
| Gene alias: | ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH |
| Gene description: | acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
| Genbank accession: | NM_000016 |
| Immunogen: | ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL |
| Protein accession: | NP_000007 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Enhanced acyl-CoA dehydrogenase activity is associated with improved mitochondrial and contractile function in heart failure.Rennison JH, McElfresh TA, Okere IC, Patel HV, Foster AB, Patel KK, Stoll MS, Minkler PE, Fujioka H, Hoit BD, Young ME, Hoppel CL, Chandler MP. Cardiovasc Res. 2008 Jul 15;79(2):331-40. Epub 2008 Mar 13. |