ACACB monoclonal antibody (M02A), clone 3E8 View larger

ACACB monoclonal antibody (M02A), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACACB monoclonal antibody (M02A), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ACACB monoclonal antibody (M02A), clone 3E8

Brand: Abnova
Reference: H00000032-M02A
Product name: ACACB monoclonal antibody (M02A), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant ACACB.
Clone: 3E8
Isotype: IgM Kappa
Gene id: 32
Gene name: ACACB
Gene alias: ACC2|ACCB|HACC275
Gene description: acetyl-Coenzyme A carboxylase beta
Genbank accession: NM_001093
Immunogen: ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
Protein accession: NP_001084
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000032-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACACB monoclonal antibody (M02A), clone 3E8 now

Add to cart