Brand: | Abnova |
Reference: | H00000032-M01A |
Product name: | ACACB monoclonal antibody (M01A), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACACB. |
Clone: | 1C11 |
Isotype: | IgM Kappa |
Gene id: | 32 |
Gene name: | ACACB |
Gene alias: | ACC2|ACCB|HACC275 |
Gene description: | acetyl-Coenzyme A carboxylase beta |
Genbank accession: | NM_001093 |
Immunogen: | ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT |
Protein accession: | NP_001084 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |