ACACA monoclonal antibody (M01), clone 6H5 View larger

ACACA monoclonal antibody (M01), clone 6H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACACA monoclonal antibody (M01), clone 6H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ACACA monoclonal antibody (M01), clone 6H5

Brand: Abnova
Reference: H00000031-M01
Product name: ACACA monoclonal antibody (M01), clone 6H5
Product description: Mouse monoclonal antibody raised against a partial recombinant ACACA.
Clone: 6H5
Isotype: IgG2a Kappa
Gene id: 31
Gene name: ACACA
Gene alias: ACAC|ACC|ACC1|ACCA
Gene description: acetyl-Coenzyme A carboxylase alpha
Genbank accession: NM_198834
Immunogen: ACACA (NP_942131, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Protein accession: NP_942131
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000031-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000031-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ACACA is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACACA monoclonal antibody (M01), clone 6H5 now

Add to cart