Brand: | Abnova |
Reference: | H00000030-M01 |
Product name: | ACAA1 monoclonal antibody (M01), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACAA1. |
Clone: | 3F11 |
Isotype: | IgG2a Kappa |
Gene id: | 30 |
Gene name: | ACAA1 |
Gene alias: | ACAA|PTHIO|THIO |
Gene description: | acetyl-Coenzyme A acyltransferase 1 |
Genbank accession: | NM_001607 |
Immunogen: | ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD |
Protein accession: | NP_001598 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver. |
Applications: | WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |