ACAA1 monoclonal antibody (M01), clone 3F11 View larger

ACAA1 monoclonal antibody (M01), clone 3F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACAA1 monoclonal antibody (M01), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ACAA1 monoclonal antibody (M01), clone 3F11

Brand: Abnova
Reference: H00000030-M01
Product name: ACAA1 monoclonal antibody (M01), clone 3F11
Product description: Mouse monoclonal antibody raised against a partial recombinant ACAA1.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 30
Gene name: ACAA1
Gene alias: ACAA|PTHIO|THIO
Gene description: acetyl-Coenzyme A acyltransferase 1
Genbank accession: NM_001607
Immunogen: ACAA1 (NP_001598, 217 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPD
Protein accession: NP_001598
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000030-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00000030-M01-2-A1-1.jpg
Application image note: ACAA1 monoclonal antibody (M01), clone 3F11. Western Blot analysis of ACAA1 expression in human liver.
Applications: WB-Ce,WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACAA1 monoclonal antibody (M01), clone 3F11 now

Add to cart