ABO monoclonal antibody (M08), clone 1B7 View larger

ABO monoclonal antibody (M08), clone 1B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABO monoclonal antibody (M08), clone 1B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ABO monoclonal antibody (M08), clone 1B7

Brand: Abnova
Reference: H00000028-M08
Product name: ABO monoclonal antibody (M08), clone 1B7
Product description: Mouse monoclonal antibody raised against a partial recombinant ABO.
Clone: 1B7
Isotype: IgG1 Kappa
Gene id: 28
Gene name: ABO
Gene alias: A3GALNT|A3GALT1|GTB|NAGAT
Gene description: ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
Genbank accession: NM_020469
Immunogen: ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Protein accession: NP_065202.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000028-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000028-M08-1-4-1.jpg
Application image note: ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ABO monoclonal antibody (M08), clone 1B7 now

Add to cart