Brand: | Abnova |
Reference: | H00000028-M08 |
Product name: | ABO monoclonal antibody (M08), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABO. |
Clone: | 1B7 |
Isotype: | IgG1 Kappa |
Gene id: | 28 |
Gene name: | ABO |
Gene alias: | A3GALNT|A3GALT1|GTB|NAGAT |
Gene description: | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) |
Genbank accession: | NM_020469 |
Immunogen: | ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP |
Protein accession: | NP_065202.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |