Brand: | Abnova |
Reference: | H00000027-M08 |
Product name: | ABL2 monoclonal antibody (M08), clone 5C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABL2. |
Clone: | 5C7 |
Isotype: | IgG3 Kappa |
Gene id: | 27 |
Gene name: | ABL2 |
Gene alias: | ABLL|ARG|FLJ22224|FLJ31718|FLJ41441 |
Gene description: | v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) |
Genbank accession: | BC065912 |
Immunogen: | ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
Protein accession: | AAH65912 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ABL2 monoclonal antibody (M08), clone 5C7 Western Blot analysis of ABL2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |