ABL2 monoclonal antibody (M04), clone 3G3 View larger

ABL2 monoclonal antibody (M04), clone 3G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABL2 monoclonal antibody (M04), clone 3G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ABL2 monoclonal antibody (M04), clone 3G3

Brand: Abnova
Reference: H00000027-M04
Product name: ABL2 monoclonal antibody (M04), clone 3G3
Product description: Mouse monoclonal antibody raised against a partial recombinant ABL2.
Clone: 3G3
Isotype: IgG2a Kappa
Gene id: 27
Gene name: ABL2
Gene alias: ABLL|ARG|FLJ22224|FLJ31718|FLJ41441
Gene description: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Genbank accession: BC065912
Immunogen: ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Protein accession: AAH65912
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000027-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000027-M04-1-25-1.jpg
Application image note: ABL2 monoclonal antibody (M04), clone 3G3 Western Blot analysis of ABL2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ABL2 monoclonal antibody (M04), clone 3G3 now

Add to cart