ABCF1 monoclonal antibody (M01), clone 1B4 View larger

ABCF1 monoclonal antibody (M01), clone 1B4

H00000023-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCF1 monoclonal antibody (M01), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about ABCF1 monoclonal antibody (M01), clone 1B4

Brand: Abnova
Reference: H00000023-M01
Product name: ABCF1 monoclonal antibody (M01), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant ABCF1.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 23
Gene name: ABCF1
Gene alias: ABC27|ABC50
Gene description: ATP-binding cassette, sub-family F (GCN20), member 1
Genbank accession: NM_001090
Immunogen: ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Protein accession: NP_001081
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000023-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ABCF1 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ABCF1 monoclonal antibody (M01), clone 1B4 now

Add to cart