ABCA1 monoclonal antibody (M01A), clone 1H4 View larger

ABCA1 monoclonal antibody (M01A), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCA1 monoclonal antibody (M01A), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ABCA1 monoclonal antibody (M01A), clone 1H4

Brand: Abnova
Reference: H00000019-M01A
Product name: ABCA1 monoclonal antibody (M01A), clone 1H4
Product description: Mouse monoclonal antibody raised against a partial recombinant ABCA1.
Clone: 1H4
Isotype: IgM Kappa
Gene id: 19
Gene name: ABCA1
Gene alias: ABC-1|ABC1|CERP|FLJ14958|HDLDT1|MGC164864|MGC165011|TGD
Gene description: ATP-binding cassette, sub-family A (ABC1), member 1
Genbank accession: NM_005502
Immunogen: ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ
Protein accession: NP_005493
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ABCA1 monoclonal antibody (M01A), clone 1H4 now

Add to cart