Brand: | Abnova |
Reference: | H00000019-M01A |
Product name: | ABCA1 monoclonal antibody (M01A), clone 1H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCA1. |
Clone: | 1H4 |
Isotype: | IgM Kappa |
Gene id: | 19 |
Gene name: | ABCA1 |
Gene alias: | ABC-1|ABC1|CERP|FLJ14958|HDLDT1|MGC164864|MGC165011|TGD |
Gene description: | ATP-binding cassette, sub-family A (ABC1), member 1 |
Genbank accession: | NM_005502 |
Immunogen: | ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ |
Protein accession: | NP_005493 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |