PX-P2077-100
New product
This product is no longer in stock
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Reference: | PX-P2077 |
Product name: | IGFBP1 protein / Human IGFBP1 full length Recombinant Protein |
Product description: | General information on IGFBP1 proteinInsulin-like growth factor-binding protein 1 (IGFBP1) was the first protein of the IGFBP superfamily to be purified. In humans, this protein is part of the insulin-like growth factor (IGF) system and it is encoded by the IGPBF1 gene. The gene is mostly expressed in the liver, kidney, decidualized endometrium and in amniotic fluid. In its mature form, IGFBP1 is a non-glycosylated 25 kDa circulating protein with an N-terminal domain and a thyroglobulin type-I domain. The IGFBP1 protein diffuses through the plasma and it binds insulin-like growth factors (IGFs). It is one of the six known IGF-binding proteins (IGFBP1-6). Its levels are highly dependent and inversely proportional to insulin concentrations. Furthermore, its levels also fluctuate during the day and are influenced by fasting periods. Circulating levels of the IGFBP1 increase overnight, achieving its peak levels during early morning and they decrease during the day achieving its lower levels during the evenings. Furthermore, fasting significantly increases the levels of these proteins during the day. IGFs circulates in the blood mostly bound to one or several of the six binding proteins (IGFBP1-6). This association prologues the half-life of the IGFs and it regulates its bioavailability and mobility. Furthermore, this complex mediates the interaction of IGFs with cell surface receptors, playing an important role in cell migration, somatic growth, cellular proliferation and glucose and free fatty acid metabolism. Low serum levels of the IGFBP1 and other binding proteins are commonly associated with insulin resistance, cardiovascular disease and hypertension in humans. Due to their role in the regulation of IGFs, the IGFBP1 protein can serve as an important biomarker for the diagnosis of early-stage alcohol-induced liver disease and other insulin-related metabolic diseases. Furthermore, due to its high levels on amniotic fluid, this protein has been also used as a biological marker of prelabor rupture of membranes (PROM), preeclampsia and it can also be used to identify the risk of premature delivery. All these conditions can result in serious or even fatal complications both the mother and the baby. Therefore, the development of efficient techniques relying on the detection of the IGFBP1 and other proteins of this system is of crucial importance for the early detection of these conditions. |
Protein sequence: | MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF |
Molecular weight (tag included): | 28.74kDa |
Purity: | 95 percent |
Fragment type: | Full-length |
Expression system: | Prokaryotic expression |
Origin species: | Human |
Host species: | Escherichia coli (E. coli) |
Buffer: | PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5% |
State in the vial: | Lyophilized |
Alternative names: | IGFBP1 full length, insulin-like growth factor binding protein 1, Insulin-like growth factor-binding protein 1 |
Uniprot id: | P08833 |
Storage condition: | IGFBP1 protein is stored:At 4 degrees for short term period (less than a week) At -20 degrees or -80 degrees for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
Delivery time: | Europe: 10-25 working days USA & Canada: 12-28 working days Rest of the world: 10-28 working days |
Delivery condition: | Room Temperature |
Related products: | Human IGFBP1 Nter Recombinant Protein Mouse L1ORF1 Recombinant Protein Plasmodium MSP1-p19 Recombinant Protein |