Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
MGMT Protein / PelB-DN10-ST (virer PelB) Recombinant Protein
PX-P2087-100
New product
Data sheet of MGMT Protein / PelB-DN10-ST (virer PelB) Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Host species | Escherichia coli (E. coli) |
More info about MGMT Protein / PelB-DN10-ST (virer PelB) Recombinant Protein
| Brand: | ProteoGenix |
| Reference: | PX-P2087 |
| Product name: | MGMT Protein / PelB-DN10-ST (virer PelB) Recombinant Protein |
| Product description: | General information on MGMT Protein :MGMT Portein, also known as Methylated-DNA--protein-cysteine methyltransferase (MGMT), is a protein encoded by the O6-methylguanine DNA methyltransferase gene. This protein is crucial for genome stability. MGMT protein is responsible of one of the rare mechanisms of direct DNA repair: the repair of the naturally occurring mutagenic DNA lesion O6-methylguanine back to guanine. The principal impact of MGMT is the removing of an alkyl from the O6-methylguanine. O6-methylguanine is a derivative of the nucleobase guanine which have a higher appetence for Thymine instead of Cytosine, causing errors during DNA replication. MGMT protein is not a true enzyme. During the removing of the alkyl group from the lesion, the enzyme is not regenerated. MGMT protein is present in every nuclear of human cells: Inactivation of the MGMT gene increase the chance of cancer emergence. The most common way of repression of the protein is by the methylation of its promoter region. According to different sources, 40% to 90% of colorectal cancers have reduced MGMT expression due to methylation of the MGMT promoter region. However, reduced or absent expression of MGMT would cause increased rates of mutation, and one or more of the mutated genes may provide the cell with a selective advantage. Many studies are focused on the expression of MGMT in different cancers like gastric carcinoma, metastatic pancreatic cancer or glioblastoma. Thanks to this important research around it, MGMT is a potential biomarker for chemotherapy response. |
| Protein sequence: | MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK |
| Molecular weight (tag included): | 38.40 kDa |
| Purity: | 10 percent |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Buffer: | PBS, pH 7.5 |
| State in the vial: | Frozen |
| Alternative names: | mgmt protein, PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase |
| Uniprot id: | P16455 |
| Storage condition: | MGMT Protein is stored:At 4 degrees for short term period (less than a week) At -20 degrees or -80 degrees for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Delivery time: | Europe: 10-25 working days USA & Canada: 12-28 working days Rest of the world: 10-28 working days |
| Delivery condition: | Dry Ice |
| Related products: | Human RNAse l Wild type Recombinant Protein Human RNAse l Mutant type Recombinant Protein Synthetic SNAP Protein |