View larger

SKIV2L monoclonal antibody (M05), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SKIV2L monoclonal antibody (M05), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SKIV2L monoclonal antibody (M05), clone 1E5

Brand: Abnova
Reference: H00006499-M05
Product name: SKIV2L monoclonal antibody (M05), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SKIV2L.
Clone: 1E5
Isotype: IgG2a Kappa
Gene id: 6499
Gene name: SKIV2L
Gene alias: 170A|DDX13|HLP|SKI2|SKI2W|SKIV2
Gene description: superkiller viralicidic activity 2-like (S. cerevisiae)
Genbank accession: NM_006929
Immunogen: SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL
Protein accession: NP_008860
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006499-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006499-M05-1-25-1.jpg
Application image note: SKIV2L monoclonal antibody (M05), clone 1E5. Western Blot analysis of SKIV2L expression in Hela S3 NE.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SKIV2L monoclonal antibody (M05), clone 1E5 now

Add to cart