View larger

CCL3 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of CCL3 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00006348-P01
Product name:	CCL3 (Human) Recombinant Protein (P01)
Product description:	Human CCL3 full-length ORF ( NP_002974.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	6348
Gene name:	CCL3
Gene alias:	G0S19-1\|LD78ALPHA\|MIP-1-alpha\|MIP1A\|SCYA3
Gene description:	chemokine (C-C motif) ligand 3
Genbank accession:	NM_002983.1
Immunogen sequence/protein sequence:	MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein accession:	NP_002974.1
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	NK cell intrinsic regulation of MIP-1Î± by granzyme M.Baschuk N, Wang N, Watt SV, Halse H, House C, Bird PI, Strugnell R, Trapani JA, Smyth MJ, Andrews DM Cell Death Dis. 2014 Mar 13;5:e1115. doi: 10.1038/cddis.2014.74.