Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ICOS Protein / Human CD278 Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about ICOS Protein / Human CD278 Recombinant Protein
| Brand: | ProteoGenix |
| Reference: | PX-P4035 |
| Product name: | ICOS Protein / Human CD278 Recombinant Protein |
| Product description: | General Information On ICOS protein:ICOS protein (Inducible T-Cell COStimulator), also known as Activation-Inducible Lymphocyte Immunomodulatory molecule (AILIM) or CD278, CVID1, belongs to CD28 family of immune costimulatory receptors. CVID1 is a disulfide-linked homodimer composed of extracellular IgV domain, an intracellular tail and a transmembrane segment. ICOS protein has two tyrosine residues within SH2 binding motifs. Signaling through the ICOS pathway is initiated once ICOS protein intereacts with its ligand, ICOSL (B7h, B7RP-1, CD275). ICOSL is present on B cells, macrophages, endothelial cell, dendritic cells, and on other non-immune cells treated with TNF-α. Resting T cells express low levels of ICOS protein. Once the T cells are activated, the protein is rapidly upregulated. Upon activation, ICOS initiates a cascade of events that can shape key aspects of the immune response. It enhances T-Cell proliferation, lymphokines secretion and up-regulation of molecules involved in cell-cell interaction. CD278 prevents the apoptosis of pre-activated T-Cells. It plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. Depending on the context of inflammatory response, ICOS can also induce Th1, Th17 and T follicular helper (Tfh) response. ICOS protein also promote B-Cell proliferation, differentiation into plasma and B-Cell antibody secretion. ICOS protein is expressed at low levels in the lunga, lymph node, thymus, peripheral blood leukocytes and in the medulla of fetal and newborn thymus. The homozygous loss of the inducible costimulator (ICOS) on activated T cells has been linked to adult onset form of common variable immunodeficiency with autosomal recessive inheritance. |
| Protein sequence: | MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Tag present: | C-terminal Fc Tag |
| Molecular weight (tag included): | 42.34kDa |
| Purity: | 70 percent |
| Fragment type: | Partial |
| Expression system: | Eukaryotic expression |
| Origin species: | Human |
| Host species: | Mammalian |
| Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| State in the vial: | Lyophilized |
| Alternative names: | CD278, AILIM, Inducible T-Cell Costimulator, Activation-Inducible Lymphocyte Immunomediatory Molecule |
| Uniprot id: | Q9Y6W8 |
| Storage condition: | ICOS protein is stored:At 4 degrees for short term period (less than a week) At -20 degrees or -80 degrees for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Delivery time: | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Delivery condition: | Blue ice (+4°) |
| Related products: | Human Galectin 8 (GAL8) recombinant protein Human Heat shock 70 kDa protein 1A(HSPA1A)/Hsp70 recombinant protein Human Interleukin-1 beta recombinant protein |