Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Data sheet of CTLA-4 Protein/ Cytotoxic T-lymphocyte protein 4 recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Homo sapiens (Human) |
| Host species | Mammalian cells |
More info about CTLA-4 Protein/ Cytotoxic T-lymphocyte protein 4 recombinant protein
| Brand: | ProteoGenix |
| Reference: | PX-P4018 |
| Product name: | CTLA-4 Protein/ Cytotoxic T-lymphocyte protein 4 recombinant protein |
| Product description: | General Information On CTLA-4 proteinCTLA-4 (cytotoxic T-lymphocyte-associated protein 4) also known as Cluster of Differentiation 152 (CD152) is a protein receptor that acts as an immune checkpoint. CD152 protein is expressed in regulatory T cells. CTLA-4 is upregulated following T cell activation. CTLA-4 is homologues to CD28 protein although they have opposite functions. CTLA-4 transmits inhibitory signals to T cells hence acting as ‘off’ switch whereas CD28 is a T-cell co-stimulatory protein. They both bind to CD80 and CD86 on antigen presenting cells. Furthermore, CD152 bind to CD80 and CD86 with a greater affinity than CD28 and surpasses CD28 activity on the ligands. Research data (Stamper et al. 2001) showed that CTLA-4 and CD80 a periodic arrangement in which bivalent CTLA-4 homodimers bridge bivalent CD80 homodimers. It is believed that this oligomerization provides the structural basis for forming unusually stable signaling complexes at the T-cell surface. The structure of CTLA-4 consist in an extracellular V domain, a transmembrane domain and a cytoplasmic tail. The membrane-bound isoform functions as a homodimer interconnected by a sulfide bond whereas the soluble isoform functions as a monomer. CTLA-4 has an intracellular domain which is believed to have no intrinsic catalytic activity. This intracellular domain, similar to that of CD28, contains one YVKM motif that binds PI3K, PP2A, SHP-2 and one proline rich motif that binds to SH3 containing proteins. It is believed that CTLA-4 inhibits T cell activity through SHP-2 and PP2A dephosphorylation of TCR-proximal signaling proteins (CD3 and LAT). |
| Protein sequence: | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSHHHHHH |
| Tag present: | C-terminal His Tag |
| Molecular weight (tag included): | 18,51 kDa |
| Purity: | 90 percent |
| Fragment type: | Partial |
| Expression system: | Eukaryotic expression |
| Origin species: | Homo sapiens (Human) |
| Host species: | Mammalian cells |
| Buffer: | 150 mM NaCl, 50 mM Tris-HCl, pH 7.5 |
| State in the vial: | Lyophilized |
| Alternative names: | CTLA-4, Cynw2, CD152, CELIAC3, CTLA-4, GSE, IDDM12, Celiac Disease 3, Cytotoxic T-lymphocyte protein 4 |
| Uniprot id: | |
| Storage condition: | CTLA-4 protein is stored:At 4 degrees for short term period (less than a week) At -20 degrees or -80 degrees for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Delivery time: | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Delivery condition: | Blue ice (+4°) |
| Related products: | Human Heat shock 70 kDa protein 1A(HSPA1A)/Hsp70 recombinant protein |