Cart 3 Product Products 290,01 € (empty)
No products
To be determined Shipping
290,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 290,01 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 290,01 €
Data sheet of VSVG Protein/ Drosophila VSVG NJ Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Fruit fry |
| Host species | Insect |
More info about VSVG Protein/ Drosophila VSVG NJ Recombinant Protein
| Brand: | ProteoGenix |
| Reference: | PX-P2099 |
| Product name: | VSVG Protein/ Drosophila VSVG NJ Recombinant Protein |
| Product description: | General Information on VSVG NJ Protein:Vesicular stomatitis virus (VSV) glycoproteins mediate both cell attachment and membrane fusion. Unlike many other low-pH-induced viral fusion proteins, their fusogenic conformational transitions is reversible. VSV-G has a three-stage fusion kinetics: I. G-protein conformational change which is reversible and pH-dependent. II. Reversible trimerization and clustering of the G-protein fusion loops. III. Folding back of a cluster of extended trimers into their post-fusion conformations. VSV NJ glycoprotein contains 517 amino acids and is glycosylated at position 178 and 335. Unlike VSV Indiana (VSIV), another major serotype of VSV, VSV NJ is not acylated. The two serotypes also differentiate in terms of antigenic structure. VSV NJ has a faster glycoprotein folding intracellularly and with less dependence on glycosylation. |
| Protein sequence: | MLSYLILAIVVSPILGKIEIVFPQHTTGDWKRVPHEYNYCPTSADKNSHGTQTGIPVELTMPKGLTTHQVDGFMCHSALW MTTCDFRWYGPKYITHSIHNEEPTDYQCLEAIKAYKDGVSFNPGFPPQSCGYGTVTDAEAHIITVTPHSVKVDEYTGEWI DPHFIGGRCKGKICETVHNSTKWFTSSDGESVCSQLFTIVGGTFFSDSEEITSMGLPETGIRSNYFPYISTEGICKMPFC RKPGYKLKNDLWFQITDPDLDKKVRDLPHIKDCDLSSSIITPGEHATDISLISDVERILDYALCQSTWSKIEAGEPVTPV DLSYLGPKNPGVGPVFTIINGSLHYFTSKYLRVELESPVIPRMEGKVAGTRIVRQLWDQWFPFGEAEIGPNGVLKTKQGY KFPLHIIGTGEVDSDIKMERTVKHWEHPHIEAAQTYLKKDDTEEVIYYGDTGVSKNPVELVEGWFSGWRSSIMGVVAVIF GFVILILLIRLIGVLSSLFRPKKRPIYKSDVEMAHFRGGHNHRHKH |
| Tag present: | C-terminal MAT Tag |
| Molecular weight (tag included): | 59.11kDa |
| Purity: | 90 percent |
| Fragment type: | Full-length |
| Expression system: | Eukaryotic expression |
| Origin species: | Fruit fry |
| Host species: | Insect |
| Buffer: | PBS, pH 7.5 |
| State in the vial: | Frozen |
| Alternative names: | VSVG, neither inactivation nor afterpotential A, Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme, PPIase,Rotamase |
| Uniprot id: | |
| Storage condition: | VSVG NJ protein is stored:At 4 degrees for short term period (less than a week) At -20 degrees or -80 degrees for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
| Delivery time: | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Delivery condition: | Dry Ice |
| Related products: | Vesicular stomatitis virus VSVG IND1 Recombinant Protein Staphylococcus 6His-Protein A |