Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
PX-P4037-100
New product
Data sheet of Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
| Proteogenix reference: | PX-P4037-100 |
| Protein delivered with tag?: | Yes |
| Product name: | Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein |
| Description: | Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. |
| Fragment type: | Partial |
| Expression system: | Eukaryotic expression |
| Molecular weight with tag if any: | 24.35kDa |
| Purity estimated: | 90% |
| Uniprot id: | P19438 |
| Uniprot link: | http://www.uniprot.org/uniprot/P19438 |
| Aliases / synonyms: | CD120A, P55, TBP1, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60, Tumor necrosis factor receptor 1, Tumor necrosis factor-binding protein 1 |
| Protein sequence (w/o tag): | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGSHHHHHH |
| Form: | Lyophilized |
| Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |