View larger

Human IGFBP1 Nter Recombinant Protein

Reference: PX-P2078-100

Condition: New product

Data sheet of Human IGFBP1 Nter Recombinant Protein

Proteogenix reference:	PX-P2078-100
Protein delivered with tag?:	Yes
Product name:	Human IGFBP1 Nter Recombinant Protein
Description:	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
Fragment type:	Partial
Expression system:	Prokaryotic expression
Molecular weight with tag if any:	17.59 kD
Purity estimated:	0.85
Protein accession:	ACO37638.1
Spec:entrez geneid:	3484
Spec:ncbi gene aliases:	hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:swissprotid:	P08833
Ncbi reference:	ACO37638.1
Uniprot id:	P08833
Uniprot link:	http://www.uniprot.org/uniprot/P08833
Aliases / synonyms:	IGFBP1 Nter, insulin-like growth factor binding protein 1, Insulin-like growth factor-binding protein 1
Protein sequence (w/o tag):	MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Form:	Lyophilized
Buffer:	PBS, pH 7.5 with 0.2mM Î²-Met
Storage condition:	4Â°C for short term (1 week), -20Â°C or -80Â°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition:	The product is shipped at ambient temperature
Delivery lead time in business days:	10-25